PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00009255001
Common NameGSBRNA2T00009255001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 295aa    MW: 32395.4 Da    PI: 6.8469
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00009255001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA96.92.2e-30159212155
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsg 55 
                          +ep+YVNaKQyq+Il+RRq+Rak+e e kl +ksrkpylheSRh+hA+rRpRg+g
  GSBRNA2T00009255001 159 QEPVYVNAKQYQAILRRRQARAKAELEMKL-IKSRKPYLHESRHQHAMRRPRGTG 212
                          69****************************.**********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.1E-31157218IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115233.275158218IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.5E-26160212IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.2E-21161183IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860163183IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.2E-21192215IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MHSKPDGGNQ IVSEAVHHHS INSLNPWQRA AAAACNASSL VEEAGDKSIA LESQDNWEST  60
NGSKSPSSRD ENGNKESPQV TSSPQESAGD YSEKSQELVH VGVTGPPHPQ LVSHTVGWAS  120
SNPYQDPYYA GMMGAYPMAY VPYGGMPHSR MPLPPEVAQE PVYVNAKQYQ AILRRRQARA  180
KAELEMKLIK SRKPYLHESR HQHAMRRPRG TGDGLQETNT EASQPKPGEK NNATQSPTSS  240
HSDQPEAWND ECRKQSEEMQ SSASKRREEA EDCSGQQWNS ISSNHTSQAR LAIK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-16159212255NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00009255001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009145533.10.0PREDICTED: nuclear transcription factor Y subunit A-9 isoform X4
SwissprotQ945M91e-133NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A078G2R40.0A0A078G2R4_BRANA; BnaA05g19990D protein
STRINGBra031242.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132681829
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.11e-133nuclear factor Y, subunit A9
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]